CoraLite® Plus 488-conjugated NXT1 Monoclonal antibody

NXT1 Monoclonal Antibody for
Cat No. CL488-67680
Clone No.2C10A2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

P15, NXT 1, NTF2-related export protein 1, MTR2, 2C10A2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-67680 targets NXT1 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30039

Product name: Recombinant human NXT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-140 aa of BC000759

Sequence: MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS

Predict reactive species
Full Name NTF2-like export factor 1
Calculated Molecular Weight 15 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC000759
Gene Symbol NXT1
Gene ID (NCBI) 29107
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UKK6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NXT1 is located in the nuclear envelope and is homologous to nuclear transport factor 2. NXT1 functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. NXT1 also heterodimerizes with Tap protein and regulates the ability of Tap protein to mediate nuclear mRNA export.

Loading...
||
New chat

Able

正在加载,请稍候...