Nesprin1/Syne-1 Polyclonal antibody

• 

  WB analysis using 31095-1-AP

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 31095-1-AP (SYNE1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin squamous cell cancer using 31095-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin squamous cell cancer tissue slide using 31095-1-AP (Nesprin1/Syne-1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Nesprin1/Syne-1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31095-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

SYNE1, 8B, C6orf98, CPG2, Enaptin

---

Tested Applications

• Positive WB detected in: HeLa cells, U2OS cells, mouse brain tissue
• Positive IHC detected in: human skin squamous cell cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31095-1-AP targets Nesprin1/Syne-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34809

  Product name: Recombinant human SYNE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 8260-8450 aa of BC039121

  Sequence: SLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLN

• Full Name: spectrin repeat containing, nuclear envelope 1
• Observed Molecular Weight: 120 kDa, 367 kDa, 642 kDa, 1000 kDa
• GenBank Accession Number: BC039121
• Gene Symbol: SYNE1
• Gene ID (NCBI): 23345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NF91
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SYNE1, also known as spectrin repeat containing nuclear envelope protein 1. It is expressed in skeletal and smooth muscle, as well as peripheral blood lymphocytes, and localizes to the nuclear membrane. Mutations in the SYNE1 gene have been associated with several diseases, including autosomal recessive spinocerebellar ataxia type 8 (also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce) and Emery-Dreifuss muscular dystrophy 4, autosomal dominant. The SYNE1 gene exhibits ubiquitous expression across various tissues, including the ovary and bone marrow. The molecular weight of the SYNE1 protein can vary depending on the specific isoform. For example, the full-length nesprin-1 isoform, also known as nesprin-1 giant, has 8797 amino acids and a molecular weight of approximately 1000 kDa. Another isoform, nesprin-1α2, has a molecular weight of about 120 kDa (PMID: 27782104). The protein has other isoforms with molecular weights of 380 kDa, 167 kDa and 642 kDa respectively.