NeuN Polyclonal antibody, PBS Only

• 

  WB analysis using 26975-1-AP (same clone as 26975-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26975-1-AP (NeuN antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26975-1-AP (same clone as 26975-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26975-1-AP (NeuN antibody) at dilution of 1:80000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26975-1-AP (same clone as 26975-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26975-1-AP (NeuN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 26975-1-AP (NeuN antibody) at dilution of 1:30000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 26975-1-AP (NeuN antibody) at dilution of 1:30000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 26975-1-AP (NeuN antibody) at dilution of 1:30000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using NeuN antibody (26975-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), GFAP antibody (60190-1-Ig, Clone: 4B2E10, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat cerebellum tissue using 26975-1-AP (NeuN antibody, green), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). The section was co-stained with 60190-1-Ig (GFAP antibody, red). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using NeuN antibody (26975-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using NeuN antibody (26975-1-AP) at dilution of 1:5000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat cerebellum tissue using 26975-1-AP (NeuN antibody, green), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). The section was co-stained with 60190-1-Ig (GFAP antibody, red). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using 26975-1-AP (NeuN antibody), at dilution of 1:100 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). The section was co-stained with 66375-1-Ig (TUBB3 antibody, green). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat cerebellum tissue using 26975-1-AP (NeuN antibody, green), at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). The section was co-stained with 60190-1-Ig (GFAP antibody, red). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 26975-1-AP (same clone as 26975-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using NeuN antibody (26975-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U-87 MG using 26975-1-AP (same clone as 26975-1-PBS)

  1X10^6 U-87 MG cells were intracellularly stained with 0.2 ug Anti-Human NeuN (26975-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 26975-1-PBS in a different storage buffer formulation.

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. 26975-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Synonyms

Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen, Neuronal nuclei antigen

---

Product Information

26975-1-PBS targets NeuN in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25689

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• Observed Molecular Weight: 46-52 kDa
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• RRID: AB_2880708
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Function

NeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).

Tissue specificity

NeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).

Involvement in disease

· NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).

Isoforms

There are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).

Post-translational modifications

Currently not known.

Cellular localization

NeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913).