Tested Applications
Positive IHC detected in | rat cerebellum tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | rat cerebellum tissue, mouse cerebellum tissue, rat brain tissue |
Positive FC (Intra) detected in | SH-SY5Y cells |
This antibody is not suitable for staining in frozen section.
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IHC | See 6 publications below |
IF | See 147 publications below |
Product Information
66836-1-Ig targets NeuN in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, goat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28016 Product name: Recombinant human NeuN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
Full Name | hexaribonucleotide binding protein 3 |
GenBank Accession Number | NM_001082575 |
Gene Symbol | NeuN |
Gene ID (NCBI) | 146713 |
RRID | AB_2882179 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | A6NFN3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for NeuN antibody 66836-1-Ig | Download protocol |
IF protocol for NeuN antibody 66836-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab Acetate enables metabolic fitness and cognitive performance during sleep disruption | ||
Microbiome The microbiota-gut-brain axis participates in chronic cerebral hypoperfusion by disrupting the metabolism of short-chain fatty acids. | ||
Redox Biol LOX-mediated ECM mechanical stress induces Piezo1 activation in hypoxic-ischemic brain damage and identification of novel inhibitor of LOX | ||
Cell Death Dis ChemR23 activation attenuates cognitive impairment in chronic cerebral hypoperfusion by inhibiting NLRP3 inflammasome-induced neuronal pyroptosis | ||
Cell Death Dis Astrocyte-derived exosomal nicotinamide phosphoribosyltransferase (Nampt) ameliorates ischemic stroke injury by targeting AMPK/mTOR signaling to induce autophagy | ||
Diabetes Regulatory Role of NF-κB on HDAC2 and Tau Hyperphosphorylation in Diabetic Encephalopathy and the Therapeutic Potential of Luteolin |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Deng (Verified Customer) (08-14-2025) | it works, but has some background (see image in mouse PVN region)
![]() |
FH Carla (Verified Customer) (02-03-2025) | We didn't have any good results
|
FH Kenzo (Verified Customer) (01-05-2024) | This monoclonal NeuN worked well for mouse tissues.
|
FH Silvia (Verified Customer) (08-11-2022) | it works well for Immunofluorescence on mature neurons
|
FH Delphine (Verified Customer) (07-25-2022) | Immunohistochemistry with the NeuN antibody on frozen spinal cord worked but the labeling must be optimized because there is a lot of background noise.
|
FH q (Verified Customer) (01-05-2022) | It is OK to use it in WB, but several non-specific bands above the expected MW.
![]() |