Tested Applications
| Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
| Positive FC (Intra) detected in | SH-SY5Y cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-66836 targets NeuN in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28016 Product name: Recombinant human NeuN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| RRID | AB_2883386 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 NeuN antibody CL488-66836 | Download protocol |
| IF protocol for CL Plus 488 NeuN antibody CL488-66836 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CL488-66836 is the CoraLite® Plus 488-conjugated NeuN Monoclonal antibody (clone 3A4C1). It has 5 citations published in Advanced Materials, Neuron, Experimental Eye Research, and bioRxiv. The associated research fields include Alzheimer's disease treatment via optogenetics, neuronal necroptosis driven by glucose hypometabolism and hyperphosphorylated Tau, phototagging of functionally identified cortical neurons, and retinal ischemia-reperfusion injury involving PI3K/AKT/mTOR signaling.
| Species | Application | Title |
|---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Neuron Glucose hypometabolism and hyperphosphorylated Tau synergistically drive neuronal necroptosis. | ||
Neuron 2P-NucTag: On-demand phototagging for molecular analysis of functionally identified cortical neurons. | ||
Exp Eye Res Geranylgeranylacetone-induced heat shock protein70 expression reduces retinal ischemia-reperfusion injury through PI3K/AKT/mTOR signaling | ||
bioRxiv 2P-NucTag: on-demand phototagging for molecular analysis of functionally identified cortical neurons |
