CoraLite® Plus 488-conjugated NeuN Monoclonal antibody

• 

  IF Staining of mouse brain using CL488-66836

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CL488-66836 (NeuN antibody) at dilution of 1:100.

• 

  IF Staining of mouse cerebellum using CL488-66836

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using CoraLite® Plus 488 NeuN antibody (CL488-66836, Clone: 3A4C1 ) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL488-66836

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using the CoraLite® Plus 488-conjugated version of this antibody, CL488-66836 (NeuN antibody), at dilution of 1:100.

• 

  FC experiment of U-87 MG using CL488-66836

  1X10^6 U-87 MG cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human NeuN (CL488-66836, Clone:3A4C1) (red), or 0.4 ug Mouse IgG1 Isotype Control (66360-1-Ig, Clone: T1F8D3F10) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  FC experiment of SH-SY5Y using CL488-66836

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human NeuN (CL488-66836, Clone:3A4C1) (red), or 0.4 ug Mouse IgG1 Isotype Control (CL488-66360, Clone: T1F8D3F10) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. CL488-66836

Clone No.3A4C1

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

Synonyms

Neuronal nuclei antigen, NeuN antigen, HRNBP3, FOX3, Fox-1 homolog C

---

Tested Applications

• Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue
• Positive FC (Intra) detected in: SH-SY5Y cells, U-87 MG cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 2 publications below

Product Information

CL488-66836 targets NeuN in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28016

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• RRID: AB_2883386
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Adv Mater; Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment; Authors - Yuewen Zhai
rat	IF	Exp Eye Res; Geranylgeranylacetone-induced heat shock protein70 expression reduces retinal ischemia-reperfusion injury through PI3K/AKT/mTOR signaling; Authors - Lirong Zhang
mouse		bioRxiv; 2P-NucTag: on-demand phototagging for molecular analysis of functionally identified cortical neurons; Authors - Jingcheng Shi