Tested Applications
Positive IF-P detected in | mouse cerebellum tissue, mouse brain tissue |
Positive FC (Intra) detected in | SH-SY5Y cells, U-87 MG cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 2 publications below |
Product Information
CL488-66836 targets NeuN in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28016 Product name: Recombinant human NeuN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
Full Name | hexaribonucleotide binding protein 3 |
GenBank Accession Number | NM_001082575 |
Gene Symbol | NeuN |
Gene ID (NCBI) | 146713 |
RRID | AB_2883386 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | A6NFN3 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 NeuN antibody CL488-66836 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
Exp Eye Res Geranylgeranylacetone-induced heat shock protein70 expression reduces retinal ischemia-reperfusion injury through PI3K/AKT/mTOR signaling | ||
bioRxiv 2P-NucTag: on-demand phototagging for molecular analysis of functionally identified cortical neurons |