CoraLite® Plus 647-conjugated NeuN Monoclonal antibody

• 

  FC experiment of SH-SY5Y using CL647-66836

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.2 ug CoraLite® Plus 647 Anti-Human NeuN (CL647-66836, Clone:3A4C1) (red), or 0.2 ug APC-65128 ; APC Mouse IgG2b Isotype Control (APC-65128, Clone: MPC-11) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. CL647-66836

Clone No.3A4C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

FC (Intra)

Synonyms

cDNA FLJ56884, FLJ56884, FLJ58356, FOX3, hCG_1776007, Homo sapiens (Human), HRNBP3, NeuN, RBFOX3

---

Tested Applications

• Positive FC (Intra) detected in: SH-SY5Y cells
• Positive FC detected in: SH-SY5Y cells

This antibody is not suitable for staining in frozen section.

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66836 targets NeuN in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28016

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• RRID: AB_2935070
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.