NeuN Monoclonal antibody, PBS Only

• 

  IHC staining of rat cerebellum using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 66836-1-Ig (NeuN antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 66836-1-Ig (NeuN antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 66836-1-Ig (NeuN antibody) at dilution of 1:20000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat cerebellum tissue using 66836-1-Ig (NeuN antibody, red), at dilution of 1:200 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). The section was co-stained with 14479-1-AP (Calbindin-D28k antibody, green). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using 66836-1-Ig (NeuN antibody), at dilution of 1:100 and CoraLite®594-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). The section was co-stained with 14479-1-AP (Calbindin-D28k Antibody, green). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using NeuN antibody (66836-1-Ig, Clone: 3A4C1 ) at dilution of 1:800 and CoraLite®647-conjugated F(ab')2 Fragment Goat Anti-Mouse IgG (H+L) (SA00014-8), CoraLite®594 GFAP antibody (CL594-60190, Clone: 4B2E10, red), NF-H/NF200 antibody (18934-1-AP, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 66836-1-Ig (same clone as 66836-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using NeuN antibody (66836-1-Ig, Clone: 3A4C1 ) at dilution of 1:800 and CoraLite®647-conjugated F(ab')2 Fragment Goat Anti-Mouse IgG (H+L) (SA00014-8), CoraLite® Plus 488 GFAP antibody (CL488-60190, Clone: 4B2E10, green), OLIG2 antibody (13999-1-AP, yellow). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

• 

  FC experiment of SH-SY5Y using 66836-1-Ig (same clone as 66836-1-PBS)

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.2 ug Anti-Human NeuN (66836-1-Ig, Clone:3A4C1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 66836-1-PBS in a different storage buffer formulation.

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. 66836-1-PBS

Clone No.3A4C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IHC, IF-P, FC (Intra), ELISA

Synonyms

3A4C1, Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen

---

Product Information

66836-1-PBS targets NeuN in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28016

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• RRID: AB_2882179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.