CoraLite®594-conjugated NeuN Monoclonal antibody

• 

  IF Staining of mouse cerebellum using CL594-66836

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using CoraLite®594 NeuN antibody (CL594-66836, Clone: 3A4C1 ) at dilution of 1:200.

• 

  IF Staining of mouse cerebellum using CL594-66836

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using CoraLite®594 NeuN antibody (CL594-66836, Clone: 3A4C1 ) at dilution of 1:200.

• 

  IF Staining of rat brain using CL594-66836

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using CoraLite®594 NeuN antibody (CL594-66836, red ) at dilution of 1:400, CoraLite® Plus 647 MAP2 antibody (CL647-84306-3, cyan), CoraLite®532 GFAP antibody (CL532-81063, golden), CoraLite® Plus 488 MBP antibody (CL488-10458, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat brain using CL594-66836

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using CoraLite®594 NeuN antibody (CL594-66836, red ) at dilution of 1:400, CoraLite® Plus 647 MAP2 antibody (CL647-84306-3, cyan), CoraLite®532 GFAP antibody (CL532-81063, golden), CoraLite® Plus 488 MBP antibody (CL488-10458, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. CL594-66836

Clone No.3A4C1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

3A4C1, Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen

---

Tested Applications

• Positive IF-P detected in: mouse cerebellum tissue, rat brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66836 targets NeuN in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28016

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• RRID: AB_3084730
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.