Biotin-conjugated NeuN Monoclonal antibody

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.
Cat No. Biotin-66836
Clone No.3A4C1

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IHC

cDNA FLJ56884, FLJ56884, FLJ58356, FOX3, hCG_1776007, Homo sapiens (Human), HRNBP3, NeuN, RBFOX3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-66836 targets NeuN in IHC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28016

Product name: Recombinant human NeuN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-100 aa of NM_001082575

Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Predict reactive species
Full Name hexaribonucleotide binding protein 3
GenBank Accession NumberNM_001082575
Gene Symbol NeuN
Gene ID (NCBI) 146713
RRIDAB_2883076
Conjugate Biotin
FormLiquid
Purification MethodProtein G purification
UNIPROT IDA6NFN3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.

Protocols

Product Specific Protocols
IHC protocol for Biotin NeuN antibody Biotin-66836Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...