Tested Applications
| Positive IHC-Autostainer detected in | human appendicitis tissue, human gliomas tissue |
| Positive IHC detected in | rat cerebellum tissue, mouse cerebellum tissue, human gliomas tissue, mouse brain tissue, human brain tissue, rat cerebellum tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat cerebellum tissue, mouse cerebellum tissue, rat brain tissue |
| Positive FC (Intra) detected in | SH-SY5Y cells |
This antibody is not suitable for staining in frozen section.
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66836-1-Ig targets NeuN in IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA, Immunofluorescence applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28016 Product name: Recombinant human NeuN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| RRID | AB_2882179 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NeuN antibody 66836-1-Ig | Download protocol |
| IF protocol for NeuN antibody 66836-1-Ig | Download protocol |
| IHC protocol for NeuN antibody 66836-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NeuN Monoclonal antibody (Cat# 66836-1-Ig) has 304 total citations. These appear in high-impact journals including Nature, Nature Neuroscience, Nature Communications, Cell Metabolism, Neuron, Science Advances, Cell Reports, Journal of Neuroinflammation, Redox Biology, Acta Neuropathologica, and Brain, Behavior, and Immunity. Research fields span neuroscience and neurology, notably Alzheimer's disease, Parkinson's disease, stroke, spinal cord injury, neuroinflammation, ferroptosis, epilepsy, and neuropathic pain, with immunofluorescence and IHC as the dominant applications.
| Species | Application | Title |
|---|---|---|
Nat Nanotechnol A disease-severity-responsive nanoparticle enables potent ghrelin messenger RNA therapy in osteoarthritis. | ||
Cell Metab The S100A8/A9 complex promotes food intake and prevents adipose tissue loss during cancer cachexia in mice. | ||
Cell Metab Acetate enables metabolic fitness and cognitive performance during sleep disruption | ||
Cyborg Bionic Syst Frequency-Specific Transcranial Photobiomodulation Elicits Complementary Glial Mechanisms for Neurovascular Protection and Amyloid Clearance in Alzheimer Disease. | ||
Nat Neurosci Mitochondrial accumulation and lysosomal dysfunction result in mitochondrial plaques in Alzheimer's disease |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Deng (Verified Customer) (08-14-2025) | it works, but has some background (see image in mouse PVN region)
 |
Carla (Verified Customer) (02-03-2025) | We didn't have any good results
|
Kenzo (Verified Customer) (01-05-2024) | This monoclonal NeuN worked well for mouse tissues.
|
Silvia (Verified Customer) (08-11-2022) | it works well for Immunofluorescence on mature neurons
|
Delphine (Verified Customer) (07-25-2022) | Immunohistochemistry with the NeuN antibody on frozen spinal cord worked but the labeling must be optimized because there is a lot of background noise.
|
q (Verified Customer) (01-05-2022) | It is OK to use it in WB, but several non-specific bands above the expected MW.
 |
