Neudesin/NENF Monoclonal antibody, PBS Only (Capture)

Neudesin/NENF Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 60131-1-PBS
Clone No.4G9E12

Host / Isotype

Mouse / IgG2a

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

NENF, Neudesin, 4G9E12, Cell immortalization-related protein 2, Neuron-derived neurotrophic factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60131-1-PBS targets Neudesin/NENF as part of a matched antibody pair:

MP50685-1: 60131-1-PBS capture and 60131-2-PBS detection (validated in Cytometric bead array)

MP50685-2: 60131-1-PBS capture and 60131-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8387

Product name: Recombinant human NENF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33-172 aa of BC008823

Sequence: QTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

Predict reactive species
Full Name neuron derived neurotrophic factor
Calculated Molecular Weight 172 aa, 19 kDa
Observed Molecular Weight 19 kDa, 16 kDa
GenBank Accession NumberBC008823
Gene Symbol NENF
Gene ID (NCBI) 29937
RRIDAB_2150987
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UMX5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neudesin neurotrophic factor (NENF, also known as CIR2, SPUF, and SCIRP10) acts as a neurotrophic factor in postnatal mature neurons enhancing neuronal survival, which is localized to mitochondria and endoplasmic reticulum by PINK1 and PARK7 (PMID: 31536960). NENF in the adult brain is expected to play roles in the maintenance and protection of neurons in an autocrine/paracrine manner (PMID: 15605373). It greatly increases cAMP levels in neural precursor cells and might activate a Gs-protein-coupled receptor that could activate the MAPK, PKA, and PI-3K signal pathways (PMID: 16547973).

Loading...
||
New chat

Able

正在加载,请稍候...