• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Neuropilin 1 Monoclonal antibody

Neuropilin 1 Monoclonal Antibody for
Cat No. CL594-60067
Clone No.2H3F6

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

BDCA4, CD304, DKFZp686A03134, DKFZp781F1414, neuropilin 1, NRP, NRP1, VEGF165R

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL594-60067 targets Neuropilin 1 in applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0931

Product name: Recombinant human NRP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC007737

Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN

Predict reactive species
Full Name neuropilin 1
Calculated Molecular Weight 103 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC007737
Gene Symbol Neuropilin 1
Gene ID (NCBI) 8829
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO14786
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.

Loading...
||
New chat Able
正在加载,请稍候...