Neuroserpin Recombinant monoclonal antibody

Neuroserpin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 85923-1-RR
Clone No.250112E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, IF-P, ELISA

Serpin I1, Peptidase inhibitor 12, PI 12, PI12, PI-12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, mouse brain tissue, pig brain tissue, mouse cerebellum tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85923-1-RR targets Neuroserpin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2819

Product name: Recombinant Human Neuroserpin protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 17-410 aa of NM_005025.4

Sequence: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Predict reactive species
Full Name serpin peptidase inhibitor, clade I (neuroserpin), member 1
Calculated Molecular Weight46 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberNM_005025.4
Gene Symbol Neuroserpin
Gene ID (NCBI) 5274
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99574
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape.

Protocols

Product Specific Protocols
IF protocol for Neuroserpin antibody 85923-1-RRDownload protocol
IHC protocol for Neuroserpin antibody 85923-1-RRDownload protocol
WB protocol for Neuroserpin antibody 85923-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...