Neuroserpin Recombinant monoclonal antibody, PBS Only

Neuroserpin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 85923-1-PBS
Clone No.250112E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Serpin I1, Peptidase inhibitor 12, PI 12, PI12, PI-12

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85923-1-PBS targets Neuroserpin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2819

Product name: Recombinant Human Neuroserpin protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 17-410 aa of NM_005025.4

Sequence: TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Predict reactive species
Full Name serpin peptidase inhibitor, clade I (neuroserpin), member 1
Calculated Molecular Weight46 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberNM_005025.4
Gene Symbol Neuroserpin
Gene ID (NCBI) 5274
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99574
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape.

Loading...
||
New chat Able
正在加载,请稍候...