Anti-Mouse Neutrophil Elastase Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98197-1-RR (same clone as 98197-1-PBS)

  1x10^6 mouse bone marrow cells were intracellularly stained with 0.25 ug Anti-Mouse Neutrophil elastase Rabbit Recombinant Antibody (98197-1-RR, Clone: 241842G3) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98197-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98197-1-RR (same clone as 98197-1-PBS)

  1x10^6 mouse bone marrow cells were intracellularly stained with 0.25 ug Anti-Mouse Neutrophil elastase Rabbit Recombinant Antibody (98197-1-RR, Clone: 241842G3) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 98197-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98197-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98197-1-RR against Mouse Neutrophil elastase were performed. The affinity constant is below 1 pM.

Neutrophil Elastase Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98197-1-PBS

Clone No.241842G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

241842G3, EC:3.4.21.37, Ela2, Elane, Elastase-2

---

Product Information

98197-1-PBS targets Neutrophil Elastase in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2126

  Product name: Recombinant Mouse Neutrophil elastase protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-260 aa of NM_015779.2

  Sequence: SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDR

• Full Name: elastase 2, neutrophil
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_015779.2
• Gene Symbol: Ela2
• Gene ID (NCBI): 50701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q3UP87
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ELA2 (Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation (PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation) (PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration (PMID:9683424).