Anti-Mouse Neutrophil Elastase Rabbit Recombinant Antibody

• 

  FC experiment of mouse bone marrow cells using 98197-1-RR

  1x10^6 mouse bone marrow cells were intracellularly stained with 0.25 ug Anti-Mouse Neutrophil elastase Rabbit Recombinant Antibody (98197-1-RR, Clone: 241842G3) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of mouse bone marrow cells using 98197-1-RR

  1x10^6 mouse bone marrow cells were intracellularly stained with 0.25 ug Anti-Mouse Neutrophil elastase Rabbit Recombinant Antibody (98197-1-RR, Clone: 241842G3) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 98197-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98197-1-RR against Mouse Neutrophil elastase were performed. The affinity constant is below 1 pM.

Neutrophil Elastase Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98197-1-RR

Clone No.241842G3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

241842G3, EC:3.4.21.37, Ela2, Elane, Elastase-2

---

Tested Applications

• Positive FC (Intra) detected in: mouse bone marrow cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98197-1-RR targets Neutrophil Elastase in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2126

  Product name: Recombinant Mouse Neutrophil elastase protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-260 aa of NM_015779.2

  Sequence: SEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRSHNDHLLTHPKDR

• Full Name: elastase 2, neutrophil
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_015779.2
• Gene Symbol: Ela2
• Gene ID (NCBI): 50701
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q3UP87
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

ELA2 (Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation (PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation) (PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration (PMID:9683424).