Mouse NOV/CCN3 Recombinant monoclonal antibody, PBS Only (Detector)

NOV/CCN3 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85731-1-PBS
Clone No.250054B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

CCN family member 3, Ccn3, Cellular communication network factor 3, Nephroblastoma-overexpressed gene protein homolog, Nov

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85731-1-PBS targets NOV/CCN3 as part of a matched antibody pair:

MP02088-1: 85731-2-PBS capture and 85731-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2856

Product name: Recombinant Mouse Nov protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 26-354 aa of NM_010930.4

Sequence: SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI

Predict reactive species
Full Name nephroblastoma overexpressed gene
Calculated Molecular Weight39 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberNM_010930.4
Gene Symbol Nov
Gene ID (NCBI) 18133
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ64299
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CCN family member 3 (CCN3), also known as Nephroblastoma overexpressed (NOV) protein, is a member of the CCN protein family (PMID: 1309586). CCN3 is predominantly expressed in the cytoplasm, nucleus, and extracellular space. As a subset of extracellular matrix proteins, it can directly bind to the integrin receptor family on the cell surface and participate in signal transduction between the cell surface and the extracellular matrix structure (PMID: 37378812). CCN3 exhibits anti-proliferative activity in normal cells and most tumor cells (PMID: 17340618). CCN3 co-localizes with connexin 43 (C×43) in the plasma membrane, and these two proteins physically interact to inhibit cell growth (PMID: 15213231). CCN3 can induce myofibroblast differentiation through the Notch pathway (PMID: 12050162). CCN can promote adhesion of endothelial cells, vascular smooth muscle cells, and fibroblasts through heparan sulfate proteoglycans (HSPG) (PMID: 30158025).

Loading...
||
New chat Able
正在加载,请稍候...