Nucleoside phosphorylase Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Nucleoside phosphorylase Recombinant monoclonal antibody, PBS Only (Detector) (86651-1-PBS)

• 

  WB analysis using 86651-1-RR (same clone as 86651-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86651-1-RR (Nucleoside phosphorylase antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86651-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02719-1

  The mean Nucleoside phosphorylase concentration was determined to be 313.73 ng/mL in Jurkat cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA sample test of MP02719-1

  Plasma of six individual healthy human donors was measured. The Nucleoside phosphorylase concentration of detected samples was determined to be 38.13 ng/mL with a range of 18.89-62.76 ng/mL.

• 

  Sandwich ELISA standard curve of MP02719-1

  Sandwich ELISA standard curve of MP02719-1, Human Nucleoside phosphorylase Recombinant Matched Antibody Pair - PBS only. 86651-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag12507. 86651-1-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL.

• 

  IF Staining of NIH/3T3 using 86651-1-RR (same clone as 86651-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using NP antibody (86651-1-RR, Clone: 251603E11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86651-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86651-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86651-1-RR against Human Nucleoside phosphorylase were performed. The affinity constant is below 1 pM.

Nucleoside phosphorylase Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 86651-1-PBS

Clone No.251603E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

Synonyms

PNP, EC:2.4.2.1, Inosine phosphorylase, Inosine-guanosine phosphorylase, PRO1837

---

Product Information

86651-1-PBS targets Nucleoside phosphorylase as part of a matched antibody pair:

MP02719-1: 86651-2-PBS capture and 86651-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12507

  Product name: Recombinant human NP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-289 aa of BC106074

  Sequence: MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

• Full Name: nucleoside phosphorylase
• Calculated Molecular Weight: 289 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC106074
• Gene Symbol: Purine nucleoside phosphorylase
• Gene ID (NCBI): 4860
• RRID: AB_3745030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00491
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Purine nucleoside phosphorylases (PNP) is a ubiquitous enzyme of purine metabolism that functions in the salvage pathway, including even those of protozoan parasites, thus enabling the cells to utilize purine bases recovered from metabolized purine ribo- and deoxyribonucleosides to synthesize purine nucleotides (PMID: 11337031, 23332162). PNP deficiency in humans leads to an impairment of T-cell function, usually with no apparent effects on B-cell function. hPNP is widely distributed in various tissues and cells of the human body, with the highest activity in kidney, peripheral lymphocytes and granulocytes (PMID: 38701712).