• Featured Product
  • KD/KO Validated

Nurr1/NR4A2 Monoclonal antibody, PBS Only

Nurr1/NR4A2 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66878-1-PBS
Clone No.1H5B4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

NR4A2, NURR1, 1H5B4, HZF 3, Immediate-early response protein NOT

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66878-1-PBS targets Nurr1/NR4A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1418

Product name: Recombinant human NR4A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 250-598 aa of BC009288

Sequence: SPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Predict reactive species
Full Name nuclear receptor subfamily 4, group A, member 2
Calculated Molecular Weight 66 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC009288
Gene Symbol Nurr1
Gene ID (NCBI) 4929
RRIDAB_2882211
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP43354
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NR4A2 belongs to the orphan nuclear receptor (NR) family referred to as NR4A family, which have been implicated in cell cycle regulation, apoptosis, inflammation, metabolism and more recently in carcinogenesis [PMID:22583411]. NR4A2 also has a role in the expression of several proteins that are necessary for the synthesis and regulation of DA, such as tyrosine hidroxilase, DA transporter, vesicular monoamine transporter 2, and cRET [PMID:22294735]. Act as a transcriptional regulator, NR4A2 is essential for the differentiation and maintenance of meso-diencephalic mdDA neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons [PMID: 17184956].

Loading...
||
New chat Able
正在加载,请稍候...