Product Information
16844-1-PBS targets OAT3/SLC22A8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9795 Product name: Recombinant human SLC22A8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-123 aa of bc022387 Sequence: MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKE Predict reactive species |
| Full Name | solute carrier family 22 (organic anion transporter), member 8 |
| Calculated Molecular Weight | 542 aa, 60 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | bc022387 |
| Gene Symbol | SLC22A8 |
| Gene ID (NCBI) | 9376 |
| RRID | AB_3663018 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TCC7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
OAT3 (encoded by SLC22A8) is widely distributed in the kidney, liver, choroid plexus, olfactory mucosa, brain, retina, and placenta, but it is pre-dominantly expressed on the basolateral membrane of renal tubular cells. OAT3 plays a crucial role in the uptake, distribution, and excretion of various endogenous/exogenous substances.



