OATP14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OATP14 Polyclonal antibody, PBS Only (17163-1-PBS)

• 

  WB analysis of PC-3 using 17163-1-AP (same clone as 17163-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 17163-1-AP (OATP14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17163-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 17163-1-AP (same clone as 17163-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17163-1-AP (OATP14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17163-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 17163-1-AP (same clone as 17163-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17163-1-AP (OATP14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17163-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 17163-1-AP (same clone as 17163-1-PBS)

  IP result of anti-OATP14 (IP:17163-1-AP, 4ug; Detection:17163-1-AP 1:800) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 17163-1-PBS in a different storage buffer formulation.

OATP14 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 17163-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

17163-1-PBS targets OATP14 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10573

  Product name: Recombinant human OATP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-391 aa of BC022461

  Sequence: VPFWYLPKSLPRSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLCTSTVQFNSLFGMVTYKPKYIEQQYGQSSSRA

• Full Name: solute carrier organic anion transporter family, member 1C1
• Calculated Molecular Weight: 712 aa, 79 kDa
• Observed Molecular Weight: 62-70 kDa
• GenBank Accession Number: BC022461
• Gene Symbol: SLCO1C1
• Gene ID (NCBI): 53919
• RRID: AB_2189706
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYB5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.