Product Information
25744-1-PBS targets OATP5A1/SLCO5A1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22620 Product name: Recombinant human SLCO5A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-128 aa of BC137424 Sequence: MDEGTGLQPGAGEQLEAPATAEAVQERCEPETLRSKSLPVLSSASCRPSLSPTSGDANPAFGCVDSSGHQELKQGPNPLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALAMLQERRCLYVVLTDSR Predict reactive species |
| Full Name | solute carrier organic anion transporter family, member 5A1 |
| Observed Molecular Weight | 110-12 kDa |
| GenBank Accession Number | BC137424 |
| Gene Symbol | SLCO5A1 |
| Gene ID (NCBI) | 81796 |
| RRID | AB_3742158 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H2Y9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



