• Featured Product
  • KD/KO Validated

OCIAD1 Monoclonal antibody, PBS Only (Capture)

OCIAD1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66698-1-PBS
Clone No.1C10C3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Ovarian cancer immunoreactive antigen domain containing 1, OCIA domain-containing protein 1, OCIA domain containing 1, OCIA, ASRIJ

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66698-1-PBS targets OCIAD1 as part of a matched antibody pair:

MP50614-1: 66698-1-PBS capture and 66698-2-PBS detection (validated in Cytometric bead array)

MP50614-2: 66698-1-PBS capture and 66698-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9977

Product name: Recombinant human OCIAD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC003409

Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

Predict reactive species
Full Name OCIA domain containing 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC003409
Gene Symbol OCIAD1
Gene ID (NCBI) 54940
RRIDAB_2882051
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NX40
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

OCIAD1 was first identified by immunoscreening of an ovarian carcinoma cDNA expression library with ascites fluid from ovarian cancer patients (PMID: 11162530). OCIAD1 has been reported as a key player in ovarian cancer cell adhesion, as well as a key player in generating ovarian cancer recurrence (PMID: 18328549; 20515946). In addition to its roles in cancer, OCIAD1 participates in maintaining stem cell potency by regulating the Jak/STAT pathway (PMID: 23972987). Several alternatively spliced forms of OCIAD1 gene have been identified. The longest form (1.4 kb) is predicted to encode for a 27.6 kDa protein of 245 amino acids. This antibody detects OCIAD1 with an apparent molecular weight of ~35 kDa as has been demonstrated by several researches (PMID: 27345969; 27345976).

Loading...
||
New chat Able
正在加载,请稍候...