Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

OCIAD1 Monoclonal antibody

OCIAD1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66698-1-Ig
Clone No. 1C10C3
Publications (2)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

1C10C3, ASRIJ, OCIA, OCIA domain containing 1, OCIA domain-containing protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for OCIAD1 in ?

Tested Applications

Positive WB detected inHeLa cells, rat testis tissue, mouse testis tissue
Positive IHC detected inhuman liver cancer tissue, human pancreas cancer tissue, rat small intestine tissue, human kidney tissue, rat stomach tissue, mouse testis tissue, human stomach cancer tissue, mouse stomach tissue, human placenta tissue, human thyroid cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue, HeLa cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66698-1-Ig targets OCIAD1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9977

Product name: Recombinant human OCIAD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC003409

Sequence: MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

Predict reactive species
Full Name OCIA domain containing 1
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC003409
Gene Symbol OCIAD1
Gene ID (NCBI) 54940
RRIDAB_2882051
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NX40
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OCIAD1 was first identified by immunoscreening of an ovarian carcinoma cDNA expression library with ascites fluid from ovarian cancer patients (PMID: 11162530). OCIAD1 has been reported as a key player in ovarian cancer cell adhesion, as well as a key player in generating ovarian cancer recurrence (PMID: 18328549; 20515946). In addition to its roles in cancer, OCIAD1 participates in maintaining stem cell potency by regulating the Jak/STAT pathway (PMID: 23972987). Several alternatively spliced forms of OCIAD1 gene have been identified. The longest form (1.4 kb) is predicted to encode for a 27.6 kDa protein of 245 amino acids. This antibody detects OCIAD1 with an apparent molecular weight of ~35 kDa as has been demonstrated by several researches (PMID: 27345969; 27345976).

Protocols

Product Specific Protocols
IF protocol for OCIAD1 antibody 66698-1-IgDownload protocol
IHC protocol for OCIAD1 antibody 66698-1-IgDownload protocol
WB protocol for OCIAD1 antibody 66698-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The OCIAD1 Monoclonal antibody (1C10C3), catalog number 66698-1-Ig, has 2 total citations. These appear in Clinical Respiratory Journal and eLife. The cited research spans lung adenocarcinoma subtyping via integrated proteomics and single-cell RNA sequencing, and CRISPRi-based identification of OCIAD1 as a regulatory determinant of mitochondrial Complex III assembly in human cells.

SpeciesApplicationTitle

Clin Respir J

Integrated Proteomic and scRNA-Seq Analysis Reveals Pyroptosis-Related Subtypes in Lung Adenocarcinoma.

Authors - Tianchang Wei
humanWB

Elife

Genome-wide CRISPRi screening identifies OCIAD1 as a prohibitin client and regulatory determinant of mitochondrial Complex III assembly in human cells.

Authors - Maxence Le Vasseur
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...