ODAM Polyclonal antibody

• 

  IHC staining of human lung cancer using 16509-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16509-1-AP (ODAM Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human lung cancer using 16509-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16509-1-AP (ODAM Antibody) at dilution of 1:200 (under 40x lens).

ODAM Polyclonal Antibody for IHC, ELISA

Cat No. 16509-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, IHC, ELISA

Synonyms

APIN, ODAM

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

16509-1-AP targets ODAM in WB, IF, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9726

  Product name: Recombinant human ODAM protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-153 aa of BC017796

  Sequence: MPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

• Full Name: odontogenic, ameloblast asssociated
• Calculated Molecular Weight: 153 aa, 17 kDa
• GenBank Accession Number: BC017796
• Gene Symbol: ODAM
• Gene ID (NCBI): 54959
• RRID: AB_2878267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A1E959
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ODAM, also named as Apin, may be incorporated in the enamel matrix at the end of mineralization process.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Cell Dev Biol; Single-Cell Sequencing Unveils the Heterogeneity of Nonimmune Cells in Chronic Apical Periodontitis.; Authors - Xinwei Lin
human	WB	Cell Adh Migr; TNF-α regulates the composition of the basal lamina and cell-matrix adhesions in gingival epithelial cells.; Authors - Masaru Mezawa
		Am J Transl Res; ODAM is a predictor for biomedical recurrence and inhibits the migration and invasion of prostate cancer.; Authors - Yun Luo
human	IF	Inflamm Res; Transcriptional regulation of human odontogenic ameloblast-associated protein gene by tumor necrosis factor-α.; Authors - Yuto Tsuruya
human	IF	Odontology; Interleukin-1β regulates odontogenic ameloblast-associated protein gene transcription in human gingival epithelial cells.; Authors - Yuto Tsuruya
human	IHC	Arch Oral Biol; Downregulation of odontogenic ameloblast-associated protein in the progression of periodontal disease affects cell adhesion, proliferation, and migration; Authors - Meng Hou