ODF2L Polyclonal antibody

• 

  WB analysis using 23887-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23887-1-AP (ODF2L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ODF2L Polyclonal Antibody for WB, ELISA

Cat No. 23887-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

KIAA1229, ODF2L, RP5 977L11.1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IF: See 1 publications below

Product Information

23887-1-AP targets ODF2L in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20897

  Product name: Recombinant human ODF2L protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-38 aa of BC009779

  Sequence: SLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKGI

• Full Name: outer dense fiber of sperm tails 2-like
• Calculated Molecular Weight: 513 aa, 60 kDa
• Observed Molecular Weight: 60-74 kDa
• GenBank Accession Number: BC009779
• Gene Symbol: ODF2L
• Gene ID (NCBI): 57489
• RRID: AB_2879351
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9ULJ1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ODF2L, also named as KIAA1229, has many isoforms with MW 60-80 kDa. The function of ODF2L (Outer dense fiber protein 2-like) remains largely unknown.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Cell Sci; BCAP is a centriolar satellite protein and inhibitor of ciliogenesis.; Authors - Paul de Saram ; KD Validated
human	WB	J Clin Invest; Targeting ODF2L is synthetic lethal with WEE1 kinase inhibition in epithelial ovarian cancer models; Authors - Jie Li ; KD Validated