OLFM4 Polyclonal antibody, PBS Only

• 

  IHC staining of human small intestine using 28432-1-AP (same clone as 28432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 28432-1-AP (OLFM4 antibody) at dilution of 1:1000 (under 10x lens). This data was developed using the same antibody clone with 28432-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 28432-1-AP (same clone as 28432-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 28432-1-AP (OLFM4 antibody) at dilution of 1:1000 (under 40x lens). This data was developed using the same antibody clone with 28432-1-PBS in a different storage buffer formulation.

OLFM4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28432-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Antiapoptotic protein GW112, bA209J19.1, GC1, GW112, hGC 1

---

Product Information

28432-1-PBS targets OLFM4 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28914

  Product name: Recombinant human OLFM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-233 aa of NM_006418

  Sequence: LGSGGSVSQLFSNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQN

• Full Name: olfactomedin 4
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: NM_006418
• Gene Symbol: OLFM4
• Gene ID (NCBI): 10562
• RRID: AB_2918163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX06
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Olfactomedin-4 (OLFM4), also named as hGC-1 (human G-CSF-stimulated clone-1) or antiapoptotic protein GW112, is a secreted glycoprotein normally expressed in bone marrow, prostate, small intestine, stomach, colon and pancreas (PMID: 11867215; PMID: 22471589). OLFM4 has been found to be up-regulated in gastrointestinal cancer and inflammatory disease including inflammatory bowel disease and H. pylori infection (PMID: 20534456). OLFM4 is involved in cellular process such as apoptosis, cell adhesion and tumor growth (PMID: 22471589; 16566923; 15059901).