OLIG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OLIG1 Polyclonal antibody, PBS Only (26763-1-PBS)

• 

  WB analysis using 26763-1-AP (same clone as 26763-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26763-1-AP (OLIG1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26763-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 26763-1-AP (same clone as 26763-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 26763-1-AP (OLIG1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26763-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 26763-1-AP (same clone as 26763-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 26763-1-AP (OLIG1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26763-1-PBS in a different storage buffer formulation.

OLIG1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26763-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Oligo1, Class E basic helix-loop-helix protein 21, Class B basic helix-loop-helix protein 6, bHLHe21, bHLHb6

---

Product Information

26763-1-PBS targets OLIG1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25128

  Product name: Recombinant human OLIG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC026989

  Sequence: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQ

• Full Name: oligodendrocyte transcription factor 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC026989
• Gene Symbol: OLIG1
• Gene ID (NCBI): 116448
• RRID: AB_3742201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAK6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The oligodendrocyte lineage-specific basic helix-loop-helix (OLIG) family of transcription factors includes OLIG1-OLIG3, which differ in tissue expression. OLIG1 and OLIG2 are specifically expressed in nervous tissue as gene regulators of oligodendrogenesis. OLIG1 and OLIG2 interact with the Nkx-2.2 homeodomain protein, which is responsible for directing ventral neuronal patterning in response to graded Sonic hedgehog signaling in the embryonic neural tube. These interactions between OLIG proteins and Nkx-2.2 appear to promote the formation of alternate cell types by inhibiting V3 interneuron development. OLIG1 and OLIG2 are abundantly expressed in oligodendroglioma and nearly absent in astrocytomas. Therefore, OLIG proteins are candidates for molecular markers of human glial brain tumors, which are the most common primary malignancies of the human brain.