Product Information
26763-1-PBS targets OLIG1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25128 Product name: Recombinant human OLIG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC026989 Sequence: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQ Predict reactive species |
| Full Name | oligodendrocyte transcription factor 1 |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC026989 |
| Gene Symbol | OLIG1 |
| Gene ID (NCBI) | 116448 |
| RRID | AB_3742201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TAK6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The oligodendrocyte lineage-specific basic helix-loop-helix (OLIG) family of transcription factors includes OLIG1-OLIG3, which differ in tissue expression. OLIG1 and OLIG2 are specifically expressed in nervous tissue as gene regulators of oligodendrogenesis. OLIG1 and OLIG2 interact with the Nkx-2.2 homeodomain protein, which is responsible for directing ventral neuronal patterning in response to graded Sonic hedgehog signaling in the embryonic neural tube. These interactions between OLIG proteins and Nkx-2.2 appear to promote the formation of alternate cell types by inhibiting V3 interneuron development. OLIG1 and OLIG2 are abundantly expressed in oligodendroglioma and nearly absent in astrocytomas. Therefore, OLIG proteins are candidates for molecular markers of human glial brain tumors, which are the most common primary malignancies of the human brain.





