OPN1SW Polyclonal antibody

• 

  IHC staining of mouse eye using 24660-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 24660-1-AP (OPN1SW antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse eye using 24660-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using OPN1SW antibody (24660-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse eye using 24660-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using OPN1SW antibody (24660-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of rat eye using 24660-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat eye tissue using OPN1SW antibody (24660-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

OPN1SW Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 24660-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

Blue sensitive opsin, Blue-sensitive opsin, BOP, CBT, Short-wave-sensitive opsin 1

---

Tested Applications

• Positive IHC detected in: mouse eye tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse eye tissue, rat eye tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24660-1-AP targets OPN1SW in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20387

  Product name: Recombinant human OPN1SW protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 265-348 aa of BC156719

  Sequence: YAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN

• Full Name: opsin 1 (cone pigments), short-wave-sensitive
• Calculated Molecular Weight: 348 aa, 39 kDa
• GenBank Accession Number: BC156719
• Gene Symbol: OPN1SW
• Gene ID (NCBI): 611
• RRID: AB_3085746
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P03999
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OPN1SW (Short-wave-sensitive opsin 1) belongs to the G-protein coupled receptor 1 family, opsin subfamily. It's one of three types of cone photoreceptors responsible for normal color vision. Inherited tritan color vision deficiencies exhibit an autosomal dominant inheritance pattern and are caused by mutations in OPN1SW (PMID: 32400513).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Christoffer (Verified Customer) (02-19-2025)

The antibody performs well on both cryosections and paraffin-embedded tissues. However, to ensure optimal results, antigen retrieval is advised for cryosections. The citrate buffer antigen retrieval technique was utilized

• Applications: Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1/500
• Cell Tissue Type: Adult mouse retina / cone photoreceptor cells