Product Information
83120-6-PBS targets OPRM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg9637 Product name: Recombinant human OPRM1 protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 1-68 aa of NM_000914.5 Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI Predict reactive species |
| Full Name | opioid receptor, mu 1 |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | NM_000914.5 |
| Gene Symbol | OPRM1 |
| Gene ID (NCBI) | 4988 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P35372-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
OPRM1 (also known as Mu opioid receptor, MOR1, MOP) is a G protein-coupled receptor that mediates the physiological effects of endogenous opioids as well as the structurally distinct opioid alkaloids including morphine and etorphine (PMID: 9618555). Mu opioid receptor modulates a wide range of physiological functions, particularly involved in the control of pain perception and reward properties (PMID: 30483121). Mu opioid receptor is the principal target of opioid drugs. It is encoded by OPRM1 gene and multiple transcript variants encoding different isoforms have been found. Mu opioid receptor contains sites for N-linked glycosylation. The transcript variants and variations of glycosylation may result in migrating bands of Mu opioid receptor (PMID: 21886594; 11359768).
