OPRM1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• OPRM1 Recombinant monoclonal antibody (83120-6-RR)

OPRM1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83120-6-RR

Clone No.261116A6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

hMOP, KIAA0403, LMOR, M OR 1, MOP

• 

  WB analysis using 83120-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83120-6-RR (OPRM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, Neuro-2a cells, mouse brain tissue, rat brain tissue, mouse spinal cord tissue, rat spinal cord tissue, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83120-6-RR targets OPRM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg9637

  Product name: Recombinant human OPRM1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-68 aa of NM_000914.5

  Sequence: MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMI

• Full Name: opioid receptor, mu 1
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_000914.5
• Gene Symbol: OPRM1
• Gene ID (NCBI): 4988
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35372-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OPRM1 (also known as Mu opioid receptor, MOR1, MOP) is a G protein-coupled receptor that mediates the physiological effects of endogenous opioids as well as the structurally distinct opioid alkaloids including morphine and etorphine (PMID: 9618555). Mu opioid receptor modulates a wide range of physiological functions, particularly involved in the control of pain perception and reward properties (PMID: 30483121). Mu opioid receptor is the principal target of opioid drugs. It is encoded by OPRM1 gene and multiple transcript variants encoding different isoforms have been found. Mu opioid receptor contains sites for N-linked glycosylation. The transcript variants and variations of glycosylation may result in migrating bands of Mu opioid receptor (PMID: 21886594; 11359768).