ORAI1 Polyclonal antibody

ORAI1 Polyclonal Antibody for WB, ELISA
Cat No. 28637-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

CRACM1, FLJ14466, ORAI1, ORAI1 L1, ORAI1 L2, Orail L2, ORAT1, Protein orai 1, TMEM142A, Transmembrane protein 142A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, A375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28637-1-AP targets ORAI1 in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29779

Product name: Recombinant human ORAI1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-75 aa of BC015369

Sequence: MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALS

Predict reactive species
Full Name ORAI calcium release-activated calcium modulator 1
Calculated Molecular Weight 301 aa, 33 kDa
Observed Molecular Weight32 kDa, 45-50 kDa
GenBank Accession NumberBC015369
Gene Symbol ORAI1
Gene ID (NCBI) 84876
RRIDAB_2881185
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96D31
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Store-operated calcium channels (SOCs) play essential functions in various physiological processes. ORAI1 is a complex glycosylated protein, it exists in several molecular weight forms: a theoretical molecular weight of 32.7 kDa of the unmodified protein and two major glycosylated proteins of ~43 kDa and ~50 kDa (PMID: 22318387). Human patients with a severe combinaed immunodeficiency (SCID) syndrome possess point mutations in Orai1 gene.

Protocols

Product Specific Protocols
WB protocol for ORAI1 antibody 28637-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...