ORAI1 Polyclonal antibody

• 

  WB analysis of A375 using 28637-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 28637-1-AP (ORAI1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 28637-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 28637-1-AP (ORAI1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

ORAI1 Polyclonal Antibody for WB, ELISA

Cat No. 28637-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

CRACM1, FLJ14466, ORAI1, ORAI1 L1, ORAI1 L2, Orail L2, ORAT1, Protein orai 1, TMEM142A, Transmembrane protein 142A

---

Tested Applications

• Positive WB detected in: A549 cells, A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28637-1-AP targets ORAI1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29779

  Product name: Recombinant human ORAI1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-75 aa of BC015369

  Sequence: MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSYSEVMSLNEHSMQALS

• Full Name: ORAI calcium release-activated calcium modulator 1
• Calculated Molecular Weight: 301 aa, 33 kDa
• Observed Molecular Weight: 32 kDa, 45-50 kDa
• GenBank Accession Number: BC015369
• Gene Symbol: ORAI1
• Gene ID (NCBI): 84876
• RRID: AB_2881185
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96D31
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Store-operated calcium channels (SOCs) play essential functions in various physiological processes. ORAI1 is a complex glycosylated protein, it exists in several molecular weight forms: a theoretical molecular weight of 32.7 kDa of the unmodified protein and two major glycosylated proteins of ~43 kDa and ~50 kDa (PMID: 22318387). Human patients with a severe combinaed immunodeficiency (SCID) syndrome possess point mutations in Orai1 gene.