ORAI3 Recombinant monoclonal antibody, PBS Only (Detector)

ORAI3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84340-2-PBS
Clone No.241568A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Transmembrane protein 142C, TMEM142C, Protein orai-3, 241568A2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84340-2-PBS targets ORAI3 as part of a matched antibody pair:

MP01228-1: 84340-3-PBS capture and 84340-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag36135

Product name: Recombinant human ORAI3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC006126

Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA

Predict reactive species
Full Name ORAI calcium release-activated calcium modulator 3
Calculated Molecular Weight 295 aa, 32 kDa
Observed Molecular Weight ~30 kDa,~60 kDa
GenBank Accession NumberBC006126
Gene Symbol ORAI3
Gene ID (NCBI) 93129
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BRQ5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508).

Loading...
||
New chat Able
正在加载,请稍候...