ORAOV1 Polyclonal antibody

• 

  IP experiment of A431 using 32706-1-AP

  IP result of anti-ORAOV1 (IP:32706-1-AP, 4ug; Detection:32706-1-AP 1:500) with A431 cells lysate 1120 ug.

ORAOV1 Polyclonal Antibody for IP, ELISA

Cat No. 32706-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, ELISA

Synonyms

CIAB1, LTO1, Oral cancer-overexpressed protein 1, Protein LTO1 homolog, TAOS1

---

Tested Applications

• Positive IP detected in: A431 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32706-1-AP targets ORAOV1 in IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38523

  Product name: Recombinant human ORAOV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-137 aa of NM_153451.2

  Sequence: MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF

• Full Name: oral cancer overexpressed 1
• Calculated Molecular Weight: 15kDa，137aa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: NM_153451.2
• Gene Symbol: ORAOV1
• Gene ID (NCBI): 220064
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WV07
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ORAOV1 (oral cancer overexpressed 1) is a candidate proto-oncogene that is frequently amplified and overexpressed in various human squamous cell carcinomas (SCCs), including oral, esophageal, and cervical cancers. In cervical cancer, silencing of ORAOV1 significantly inhibits the growth of HeLa cells by causing S-phase cell cycle arrest and activating apoptosis. Additionally, ORAOV1 is overexpressed in a variety of solid tumors and may promote tumor development by preventing ribosomal damage induced by reactive oxygen species (ROS). Therefore, ORAOV1 is not only an important tumor biomarker but also a potential therapeutic target for multiple cancers.