ORC2L Polyclonal antibody

• 

  WB analysis of HepG2 using 12739-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12739-1-AP (ORC2L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12739-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12739-1-AP (ORC2L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 12739-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 12739-1-AP (ORC2L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 12739-1-AP

  IP result of anti-ORC2L (IP:12739-1-AP, 4ug; Detection:12739-1-AP 1:300) with HepG2 cells lysate 1200ug.

ORC2L Polyclonal Antibody for WB, IP, ELISA

Cat No. 12739-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

ORC2, ORC2L

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12739-1-AP targets ORC2L in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3635

  Product name: Recombinant human ORC2L protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 208-578 aa of BC014834

  Sequence: SQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHKWMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA

• Full Name: origin recognition complex, subunit 2-like (yeast)
• Calculated Molecular Weight: 577 aa, 66 kDa
• Observed Molecular Weight: 70-74 kDa
• GenBank Accession Number: BC014834
• Gene Symbol: ORC2L
• Gene ID (NCBI): 4999
• RRID: AB_10640799
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13416
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.