Home
Products
Primary Antibodies
OSBPL3 Polyclonal antibody, PBS Only (12417-1-PBS)

OSBPL3 Polyclonal antibody, PBS Only

Name: OSBPL3 Polyclonal antibody, PBS Only,
Brand: Proteintech

OSBPL3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12417-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

KIAA0704, ORP 3, ORP3, ORP-3, OSBP related protein 3

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 12417-1-AP (same clone as 12417-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HCT 116 using 12417-1-AP (same clone as 12417-1-PBS)
WB result of OSBPL3 antibody (12417-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-OSBPL3 transfected HCT 116 cells. This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 12417-1-AP (same clone as 12417-1-PBS)
K-562 cells were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse bladder using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat bladder using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat bladder tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 12417-1-AP (same clone as 12417-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

12417-1-PBS targets OSBPL3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3044 Product name: Recombinant human OSBPL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC017731 Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA Predict reactive species
Full Name	oxysterol binding protein-like 3
Calculated Molecular Weight	887 aa, 101 kDa
Observed Molecular Weight	95-110 kDa
GenBank Accession Number	BC017731
Gene Symbol	OSBPL3
Gene ID (NCBI)	26031
RRID	AB_2156103
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H4L5
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

OSBPL3 (ORP3) is an oxysterol-binding protein-related lipid transfer protein located at ER-plasma membrane contact sites. Its canonical isoform contains 887 amino acids with a theoretical molecular weight of 101.2 kDa. Western blot routinely detects a doublet around 103 kDa and 110 kDa, mainly caused by differential phosphorylation rather than splicing variants. It interacts with R-Ras and VAPA to modulate PI4P transport, actin cytoskeleton dynamics and cell adhesion. Aberrant OSBPL3 expression drives proliferation and metastasis in multiple cancers, acting as a prognostic biomarker and potential therapeutic target. (PMID: 32041906, 34584127)