OSBPL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• OSBPL3 Polyclonal antibody, PBS Only (12417-1-PBS)

• 

  WB analysis using 12417-1-AP (same clone as 12417-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 12417-1-AP (same clone as 12417-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 12417-1-AP (OSBPL3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 Antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 12417-1-AP (same clone as 12417-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12417-1-AP (OSBPL3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12417-1-PBS in a different storage buffer formulation.

OSBPL3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12417-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

OSBP3, OSBP related protein 3, ORP-3, ORP3, ORP 3

---

Product Information

12417-1-PBS targets OSBPL3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3044

  Product name: Recombinant human OSBPL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC017731

  Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA

• Full Name: oxysterol binding protein-like 3
• Calculated Molecular Weight: 887 aa, 101 kDa
• Observed Molecular Weight: 95-110 kDa
• GenBank Accession Number: BC017731
• Gene Symbol: OSBPL3
• Gene ID (NCBI): 26031
• RRID: AB_2156103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The oxysterol-binding protein-like (OSBPL) protein family includes nine members namely OSBPL2, OSBPL3, OSBPL5, OSBPL6, OSBPL7, OSBPL8, OSBPL9, OSBPL10, and OSBPL11. The OSBPL family proteins (OSBPLs) are located at the membrane to exchange molecules or signals between organelles and function as a necessary transporter. In addition to lipid transport, the OSBPLs are involved in the regulation of the actin cytoskeleton, cell polarity, and cell. Recently, the role of OSBPLs in cancer development has been gradually revealed. Upregulation of OSBPL3 could promote colorectal cancer. (PMID: 36918840)