OTUD6B Recombinant monoclonal antibody

• 

  WB analysis using 87049-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87049-1-RR (OTUD6B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 87049-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed Jurkat cells using OTUD6B antibody (87049-1-RR, Clone: 251982E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

OTUD6B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87049-1-RR

Clone No.251982E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CGI 77, CGI-77, Deubiquitinase OTUD6B, DUBA 5, DUBA5

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HEK-293T cells, A431 cells, Raji cells
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87049-1-RR targets OTUD6B in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22044

  Product name: Recombinant human OTUD6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC029760

  Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH

• Full Name: OTU domain containing 6B
• Calculated Molecular Weight: 293 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC029760
• Gene Symbol: OTUD6B
• Gene ID (NCBI): 51633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N6M0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 87049-1-RR can detect the band around 34 kDa.(PMID:32323143)