OTUD6B Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 87049-1-RR (same clone as 87049-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87049-1-RR (OTUD6B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87049-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 87049-1-RR (same clone as 87049-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed Jurkat cells using OTUD6B antibody (87049-1-RR, Clone: 251982E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87049-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02964-1

  The mean OTUD6B concentration was determined to be 177.4 ng/mL in 769-P cell extract based on a 1.2 mg/mL extract load, 83.1 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 129.1 ng/mL in U2OS cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02964-1

  Cytometric bead array standard curve of MP02964-1, OTUD6B Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87049-1-PBS. Detection antibody: 87049-2-PBS. Standard: Ag22044. Range: 0.781-100 ng/mL.

OTUD6B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 87049-1-PBS

Clone No.251982E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

CGI 77, CGI-77, Deubiquitinase OTUD6B, DUBA 5, DUBA5

---

Product Information

87049-1-PBS targets OTUD6B as part of a matched antibody pair:

MP02964-1: 87049-1-PBS capture and 87049-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22044

  Product name: Recombinant human OTUD6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC029760

  Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH

• Full Name: OTU domain containing 6B
• Calculated Molecular Weight: 293 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC029760
• Gene Symbol: OTUD6B
• Gene ID (NCBI): 51633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N6M0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 87049-1-RR can detect the band around 34 kDa.(PMID:32323143)