CoraLite® Plus 488-conjugated OTUD6B Monoclonal antibody

OTUD6B Monoclonal Antibody for IF/ICC
Cat No. CL488-68450
Clone No.1D1G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

1D1G1, CGI 77, CGI-77, Deubiquitinase OTUD6B, DUBA 5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68450 targets OTUD6B in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33607

Product name: Recombinant human OTUD6B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-157 aa of BC029760

Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH

Predict reactive species
Full Name OTU domain containing 6B
Calculated Molecular Weight 293 aa, 34 kDa
Observed Molecular Weight 34-40 kDa
GenBank Accession NumberBC029760
Gene Symbol OTUD6B
Gene ID (NCBI) 51633
RRIDAB_3673018
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8N6M0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 68450-1-Ig can detect the band around 34 kDa.(PMID:32323143)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 OTUD6B antibody CL488-68450Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...