PP11 Polyclonal antibody

• 

  WB analysis of mouse lung using 18002-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 18002-1-AP (PP11 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 18002-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 18002-1-AP (PP11 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 18002-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18002-1-AP (PP11 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 18002-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18002-1-AP (PP11 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 18002-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 18002-1-AP (PP11 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

PP11 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18002-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

26 serine protease, ENDOU, P11, Placental protein 11, PP11, Protein endoU, PRSS26

---

Tested Applications

• Positive WB detected in: mouse lung tissue, HeLa cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 2 publications below

Product Information

18002-1-AP targets PP11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12494

  Product name: Recombinant human P11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-369 aa of BC074763

  Sequence: MRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST

• Full Name: 26 serine protease
• Calculated Molecular Weight: 369 aa, 42 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC074763
• Gene Symbol: PP11
• Gene ID (NCBI): 8909
• RRID: AB_10598470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21128
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Am J Obstet Gynecol; Trophoblast apoptosis from pregnancies complicated by fetal growth restriction is associated with enhanced p53 expression.; Authors - Roni Levy
human	IHC	J Clin Biochem Nutr; Upregulation of ENDOU in cytotrophoblasts from placenta complicated with preeclampsia and fetal growth restriction.; Authors - Masataka Nomoto