P130 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• P130 Recombinant monoclonal antibody, PBS Only (87016-1-PBS)

• 

  WB analysis using 87016-1-RR (same clone as 87016-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87016-1-RR (P130 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87016-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 87016-1-RR (same clone as 87016-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 87016-1-RR (P130 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87016-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 87016-1-RR (same clone as 87016-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using P130 antibody (87016-1-RR, Clone: 252136E4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87016-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 87016-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87016-1-RR against Human P130 were performed. The affinity constant is 2.70 nM.

P130 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87016-1-PBS

Clone No.252136E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

NOLC1, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035, NOPP130

---

Product Information

87016-1-PBS targets P130 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2382

  Product name: Recombinant human P130 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-418 aa of BC006769

  Sequence: TKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE

• Full Name: nucleolar and coiled-body phosphoprotein 1
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC006769
• Gene Symbol: NOLC1
• Gene ID (NCBI): 9221
• RRID: AB_3745276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14978
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Nucleolar and coiled-body phosphoprotein 1 (NOLC1) is a phosphoprotein that transiently associates with the mature nucleolar H/ACA and C/D box small nucleolar ribonucleoproteins (snoRNPs), guiding site-specific 2'-O-meth-ylation and pseudouridylation of pre-rRNAs [PMID:21266110]. It contains a nuclear localization signal binding sequence and is thought to shuttle between the nucleolus and the cytoplasm. NOLC1 plays an essential role in the synthesis of rRNA and the biosynthesis of ribosomes [PMID:8972203].