P130 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• P130 Recombinant monoclonal antibody (87016-1-RR)

• 

  WB analysis using 87016-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87016-1-RR (P130 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 87016-1-RR

  rat brain tissue were subjected to SDS PAGE followed by western blot with 87016-1-RR (P130 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 87016-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using P130 antibody (87016-1-RR, Clone: 252136E4 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 87016-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87016-1-RR against Human P130 were performed. The affinity constant is 2.70 nM.

P130 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87016-1-RR

Clone No.252136E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

NOLC1, HCV NS5A-transactivated protein 13, Hepatitis C virus NS5A-transactivated protein 13, KIAA0035, NOPP130

---

Tested Applications

• Positive WB detected in: Jurkat cells, rat brain tissue, K-562 cells, HeLa cells, Caki-1 cells, HEK-293 cells, Sp2/0 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87016-1-RR targets P130 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2382

  Product name: Recombinant human P130 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 69-418 aa of BC006769

  Sequence: TKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE

• Full Name: nucleolar and coiled-body phosphoprotein 1
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC006769
• Gene Symbol: NOLC1
• Gene ID (NCBI): 9221
• RRID: AB_3745276
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14978
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleolar and coiled-body phosphoprotein 1 (NOLC1) is a phosphoprotein that transiently associates with the mature nucleolar H/ACA and C/D box small nucleolar ribonucleoproteins (snoRNPs), guiding site-specific 2'-O-meth-ylation and pseudouridylation of pre-rRNAs [PMID:21266110]. It contains a nuclear localization signal binding sequence and is thought to shuttle between the nucleolus and the cytoplasm. NOLC1 plays an essential role in the synthesis of rRNA and the biosynthesis of ribosomes [PMID:8972203].