Home
Products
Primary Antibodies
P27; KIP1 Polyclonal antibody, PBS Only (25614-1-PBS)

Filter: AllWBIPIHCIF-PIF/ICCFC (Intra)

WB analysis using 25614-1-AP (same clone as 25614-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis using 25614-1-AP (same clone as 25614-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis using 25614-1-AP (same clone as 25614-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 25614-1-AP (same clone as 25614-1-PBS)
WB result of P27; KIP1 antibody (25614-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-P27; KIP1 transfected HeLa cells. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis using 25614-1-AP (same clone as 25614-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis using 25614-1-AP (same clone as 25614-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 25614-1-AP (same clone as 25614-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
WB analysis of NIH/3T3 using 25614-1-AP (same clone as 25614-1-PBS)
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25614-1-AP (P27; KIP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IP experiment of NIH/3T3 using 25614-1-AP (same clone as 25614-1-PBS)
IP result of anti-P27; KIP1 (IP:25614-1-AP, 4ug; Detection:25614-1-AP 1:1000) with NIH/3T3 cells lysate 1160 ug. This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25614-1-AP (P27; KIP1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 25614-1-AP (P27; KIP1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25614-1-AP (P27; KIP1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25614-1-AP (P27; KIP1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25614-1-AP (P27; KIP1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25614-1-AP (P27; KIP1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25614-1-AP (P27; KIP1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 25614-1-AP (same clone as 25614-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25614-1-AP (P27; KIP1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 25614-1-AP (same clone as 25614-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using P27; KIP1 antibody (25614-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IF Staining of mouse testis using 25614-1-AP (same clone as 25614-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using P27; KIP1 antibody (25614-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 25614-1-AP (same clone as 25614-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using P27; KIP1 antibody (25614-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
FC experiment of MCF-7 using 25614-1-AP (same clone as 25614-1-PBS)
1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human P27; KIP1 (25614-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.
×
1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human P27; KIP1 (25614-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 25614-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

P27; KIP1 Polyclonal antibody, PBS Only

Name: P27; KIP1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 25614-1-PBS

P27; KIP1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA

Cat No. 25614-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA

Synonyms

CDKN1B, P27, CDKN4, Cyclin-dependent kinase inhibitor 1B, Cyclin-dependent kinase inhibitor p27

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

25614-1-PBS targets P27; KIP1 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22582 Product name: Recombinant human P27; KIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-198 aa of BC001971 Sequence: DLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT Predict reactive species
Full Name	cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Calculated Molecular Weight	198 aa, 22 kDa
Observed Molecular Weight	27 kDa
GenBank Accession Number	BC001971
Gene Symbol	p27 Kip1/CDKN1B
Gene ID (NCBI)	1027
RRID	AB_2880161
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P46527
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CDKN1B, also named as P27 or KIP1, is a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. P27 binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controlling cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Downregulation of P27 has been implicated in the progression of several malignancies, including lung cancer, hepatocellular carcinoma, salivary cancer, oral squamous cell carcinomas, and gastric cancer.