P2RX4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• P2RX4 Polyclonal antibody (13534-1-AP)

• Featured Product
• KD/KO Validated

P2RX4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13534-1-AP

Publications(19)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

ATP receptor, P2X purinoceptor 4, P2X4, P2X4R, Purinergic receptor

• 

  WB analysis of HeLa using 13534-1-AP

  WB result of P2RX4 antibody (13534-1-AP; 1:4000; room temperature for 1.5 hours) with wild-type and P2RX4 knockout HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13534-1-AP

  WB result of P2RX4 antibody (13534-1-AP; 1:4000; room temperature for 1.5 hours) with sh-control and sh-P2RX4 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 13534-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13534-1-AP (P2RX4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13534-1-AP targets P2RX4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4445

  Product name: Recombinant human P2RX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-341 aa of BC033826

  Sequence: TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS

• Full Name: purinergic receptor P2X, ligand-gated ion channel, 4
• Calculated Molecular Weight: 388 aa, 43 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: BC033826
• Gene Symbol: P2RX4
• Gene ID (NCBI): 5025
• RRID: AB_2236528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2RX4 (P2X purinoceptor 4) is a receptor for ATP acting as a ligand gated ion channel. The calculated molecular weight of P2RX4 is 43 kDa, larger apparent molecular weights of 50-80 kDa have been reported, possibly due to post-translational glycosylation (PMID: 24040145, 15262999; 29382907; 12566439). The antibody can detect the band around 45 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Autophagy; Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy; Authors - Kui Wang
mouse	WB	Sci Adv; α-Ketoglutaric acid ameliorates hyperglycemia in diabetes by inhibiting hepatic gluconeogenesis via serpina1e signaling.; Authors - Yexian Yuan ; KD Validated
human	IHC	Front Oncol; An Inflammatory Response-Related Gene Signature Can Impact the Immune Status and Predict the Prognosis of Hepatocellular Carcinoma.; Authors - Zhuo Lin
mouse	WB	Exp Neurol; Neuroprotective and neuro-rehabilitative effects of acute purinergic receptor P2X4 (P2X4R) blockade after ischemic stroke.; Authors - Pranay Srivastava
human	IF	CNS Neurosci Ther; Activation of P2X4 receptor exacerbates acute brain injury after intracerebral hemorrhage.; Authors - Si-Ting Wu
mouse	IHC	J Headache Pain; Microglia P2X4R-BDNF signalling contributes to central sensitization in a recurrent nitroglycerin-induced chronic migraine model.; Authors - Ting Long