PABPC1L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PABPC1L Polyclonal antibody, PBS Only (31907-1-PBS)

• 

  WB analysis using 31907-1-AP (same clone as 31907-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31907-1-AP (PABPC1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31907-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31907-1-AP (same clone as 31907-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31907-1-AP (PABPC1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31907-1-PBS in a different storage buffer formulation.

PABPC1L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31907-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Polyadenylate-binding protein 1-like

---

Product Information

31907-1-PBS targets PABPC1L in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36248

  Product name: Recombinant human PABPC1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-530 aa of NM_001124756

  Sequence: RLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEP

• Full Name: poly(A) binding protein, cytoplasmic 1-like
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001124756
• Gene Symbol: PABPC1L
• Gene ID (NCBI): 80336
• RRID: AB_3742490
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAP1L, also known as PABPC1L, is a human gene that has been associated with various cellular processes, particularly in the context of reproduction and embryonic development. PABPC1L was markedly upregulated in RCC, and high PABPC1L expression correlated with unfavorable prognosis and resistance to ICB (PMID: 38382068).