Tested Applications
| Positive WB detected in | HeLa cells, mouse heart tissue, human brain tissue, Jurkat cells |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14960-1-AP targets PABPC4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6813 Product name: Recombinant human PABPC4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 285-631 aa of BC065540 Sequence: QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS Predict reactive species |
| Full Name | poly(A) binding protein, cytoplasmic 4 (inducible form) |
| Calculated Molecular Weight | 70 kDa |
| Observed Molecular Weight | 70-71 kDa |
| GenBank Accession Number | BC065540 |
| Gene Symbol | PABPC4 |
| Gene ID (NCBI) | 8761 |
| RRID | AB_2156897 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13310 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PABPC4 antibody 14960-1-AP | Download protocol |
| IHC protocol for PABPC4 antibody 14960-1-AP | Download protocol |
| IP protocol for PABPC4 antibody 14960-1-AP | Download protocol |
| WB protocol for PABPC4 antibody 14960-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PABPC4 antibody (Cat# 14960-1-AP) has 12 total citations. These appear in journals including Nature Cell Biology, Nucleic Acids Research, Advanced Science, Nature Structural & Molecular Biology, PNAS, Cell Reports, EMBO Reports, PLoS Pathogens, Journal of Immunology, BMC Pregnancy and Childbirth, Veterinary Sciences, and Translational Andrology and Urology. Research fields span mRNA processing and metastasis, RNA modification and bladder cancer, circular RNA and cancer resistance, stress granule proteomics, ubiquitination and antiviral responses, MHC regulation, preeclampsia, viral autophagy, and prostate cancer.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol An mRNA processing pathway suppresses metastasis by governing translational control from the nucleus | ||
Nucleic Acids Res Comprehensive analysis of the BC200 ribonucleoprotein reveals a reciprocal regulatory function with CSDE1/UNR. | ||
Adv Sci (Weinh) m(5)C-Modified tRF3b-Cys(GCA)-23 Suppresses Bladder Cancer Malignancy by Repressing H3K18 Lactylation via Stabilizing RBM4. | ||
Nat Struct Mol Biol Poised PABP-RNA hubs implement signal-dependent mRNA decay in development | ||
Proc Natl Acad Sci U S A A circular RNA overcomes acquired resistance to BET inhibitors by antagonizing IGF2BP2-mediated c-MYC translation in TNBC. | ||
Cell Rep The proteome and transcriptome of stress granules and P bodies during human T lymphocyte activation |
Reviews
What customers say
The single review for this antibody reports a 5-star rating from an immunofluorescence application. The user found it worked well at a 1:500 dilution, incubated overnight at 4°C, on RPE-1 cells. Overall, the feedback is positive, with the reviewer confirming reliable performance for IF under these conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Abe (Verified Customer) (04-25-2024) | Worked well for IF at 1:500 overnight in 4c for RPE-1 cells.
|
