CoraLite® Plus 488-conjugated PACSIN2 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-84763-4

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 PACSIN2 antibody (CL488-84763-4, Clone: 242193H3 ) at dilution of 1:200.

PACSIN2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84763-4

Clone No.242193H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

Protein kinase C and casein kinase substrate in neurons protein 2, SdpII, Syndapin-2, Syndapin-II

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84763-4 targets PACSIN2 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0809

  Product name: Recombinant human PACSIN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-486 aa of BC008037

  Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ

• Full Name: protein kinase C and casein kinase substrate in neurons 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008037
• Gene Symbol: PACSIN2
• Gene ID (NCBI): 11252
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UNF0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Peripheral membrane proteins of the Bin/amphiphysin/Rvs (BAR) and Fer-CIP4 homology-BAR (F-BAR) family participate in cellular membrane trafficking (PMID: 19549836). PACSIN2 (also known as syndapin-2) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family, which are membrane-binding proteins characterized by an amino-terminal F-BAR domain. PACSIN2 plays a role in intracellular vesicle-mediated transport. It is involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization (PMID: 23129763). PACSIN2 also has a role in caveolae membrane sculpting (PMID: 21610094).