CoraLite® Plus 488-conjugated PADI2 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66386

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 PADI2 antibody (CL488-66386, Clone: 2D8C12 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

PADI2 Monoclonal Antibody for IF/ICC

Cat No. CL488-66386

Clone No.2D8C12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

KIAA0994, PAD H19, PAD2, PADI2, PDI2, Peptidylarginine deiminase II

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66386 targets PADI2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17612

  Product name: Recombinant human PADI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-438 aa of BC009701

  Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL

• Full Name: peptidyl arginine deiminase, type II
• Calculated Molecular Weight: 665 aa, 75 kDa
• GenBank Accession Number: BC009701
• Gene Symbol: PADI2
• Gene ID (NCBI): 11240
• RRID: AB_2883324
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y2J8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PADI2, also named as KIAA0994, PDI2, PAD-H19 and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa. This antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.