PAFAH2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAFAH2 Polyclonal antibody, PBS Only (10085-1-PBS)

• 

  WB analysis of mouse liver using 10085-1-AP (same clone as 10085-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10085-1-AP (PAFAH2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10085-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 10085-1-AP (same clone as 10085-1-PBS)

  IP result of anti-PAFAH2 (IP:10085-1-AP, 4ug; Detection:10085-1-AP 1:300) with mouse liver tissue lysate 6400ug. This data was developed using the same antibody clone with 10085-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 10085-1-AP (same clone as 10085-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 10085-1-AP (PAFAH2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10085-1-PBS in a different storage buffer formulation.

PAFAH2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10085-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

EC:2.3.1.149, EC:3.1.1.47, HSD PLA2, hSD-PLA2, PAF:lysophospholipid transacetylase

---

Product Information

10085-1-PBS targets PAFAH2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0124

  Product name: Recombinant human PAFAH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-392 aa of BC001158

  Sequence: WIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

• Full Name: platelet-activating factor acetylhydrolase 2, 40kDa
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 44-46 kDa
• GenBank Accession Number: BC001158
• Gene Symbol: PAFAH2
• Gene ID (NCBI): 5051
• RRID: AB_2160055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The family of platelet-activating factor-acetylhydrolase (PAF-AH) consists of enzymes which catalyze the hydrolysis of acetyl ester at the sn-2 position of PAF(Platelet-activating factor). The intracellular type II PAF-AH is a single polypeptide about a 40 kd distributed in both the cytosol and membranes of many kinds of cells.