PAFAH2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PAFAH2 Polyclonal antibody, PBS Only (10085-1-PBS)

PAFAH2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 10085-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

EC:2.3.1.149, EC:3.1.1.47, HSD PLA2, hSD-PLA2, PAF:lysophospholipid transacetylase

• 

  WB analysis of mouse liver using 10085-1-AP (same clone as 10085-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10085-1-AP (PAFAH2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10085-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 10085-1-AP (same clone as 10085-1-PBS)

  IP result of anti-PAFAH2 (IP:10085-1-AP, 4ug; Detection:10085-1-AP 1:500) with mouse testis tissue lysate 1400 ug. This data was developed using the same antibody clone with 10085-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

10085-1-PBS targets PAFAH2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0124

  Product name: Recombinant human PAFAH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 165-392 aa of BC001158

  Sequence: WIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

• Full Name: platelet-activating factor acetylhydrolase 2, 40kDa
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa and 80 kDa
• GenBank Accession Number: BC001158
• Gene Symbol: PAFAH2
• Gene ID (NCBI): 5051
• RRID: AB_2160055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99487
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Platelet-activating factor acetylhydrolase 2 (PAFAH2), also known as PAF-AH II, is an intracellular phospholipase A2 enzyme that hydrolyzes platelet-activating factor (PAF) and oxidatively fragmented phospholipids (PMID: 34116047). Belonging to the PAFAH family, PAFAH2 shares significant homology with plasma PAFAH (PLA2G7) but is distinct in its intracellular localization (PMID: 8955149). The enzyme features an α/β-hydrolase fold with a Ser-His-Asp catalytic triad and does not require Ca²⁺ for activity (PMID: 34116047). PAF-AH II expresses in almost all tissues, but predominantly in epithelial cells such as renal proximal and distal tubules, hepatocytes, and intestinal column epithelium. PAFAH2 isolated from mammalian cells was found to be both a monomer and dimer. In an unstressed situation, PAFAH2 as a dimer remains in the cytoplasm, and when exposed to oxidative stress, the homodimers of PAFAH2 dissociate into monomers to bind to membranes, ER, and Golgi apparatus (PMID: 34116047).