Use Able AI chat for product recommendations

PAH Polyclonal antibody

PAH Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

EC:1.14.16.1, PH, Phe-4-monooxygenase, Phenylalanine-4-hydroxylase, PKU

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PAH in ?

Tested Applications

Positive WB detected inmouse kidney tissue, HepG2 cells, mouse liver tissue, rat liver tissue
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16347-1-AP targets PAH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9541

Product name: Recombinant human PAH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 177-452 aa of BC026251

Sequence: VEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK

Predict reactive species
Full Name phenylalanine hydroxylase
Calculated Molecular Weight 452 aa, 52 kDa
Observed Molecular Weight 45-52 kDa
GenBank Accession NumberBC026251
Gene Symbol PAH
Gene ID (NCBI) 5053
RRIDAB_2878247
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00439
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAH, also known as PH, belongs to the aromatic amino acid hydroxylase (AAAH) enzyme family. PAH catalyzes the conversion of L-phenylalanine (L-Phe) to L-tyrosine (L-Tyr) by para-hydroxylation of the aromatic side chain. PAH is primarily present in the liver, where removal of excess L-Phe prevents the neurotoxic effect of hyperphenylalaninemia (HPA). (PMID: 23457044)

Protocols

Product Specific Protocols
IHC protocol for PAH antibody 16347-1-APDownload protocol
WB protocol for PAH antibody 16347-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PAH Polyclonal antibody (Cat# 16347-1-AP) has 5 citations published in Advanced Science, Pharmacological Research, Arthritis Research & Therapy, iScience, and Life Science Alliance. The research spans leukemia immunotherapy, ischemic stroke and endothelial pyroptosis, lupus nephritis ferroptosis, esophageal carcinoma palmitoylation signatures, and PKD3-mediated glucose/tyrosine metabolism. Applications cited include WB and IHC in human and mouse samples.

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

A Metabolic Reprogramming Amino Acid Polymer as an Immunosurveillance Activator and Leukemia Targeting Drug Carrier for T‐Cell Acute Lymphoblastic Leukemia

Authors - Changzheng Li
mouseWB

Pharmacol Res

Medioresinol as a novel PGC-1α activator prevents pyroptosis of endothelial cells in ischemic stroke through PPARα-GOT1 axis.

Authors - Yunjie Wang
humanIHC

Arthritis Res Ther

Investigation of ferroptosis-associated molecular subtypes and immunological characteristics in lupus nephritis based on artificial neural network learning

Authors - Li Zhang

iScience

A palmitoylation signature for prognosis immune infiltration and drug sensitivity in esophageal carcinoma.

Authors - Chuan Xu
mouseWB

Life Sci Alliance

A phosphoproteomic approach reveals that PKD3 controls PKA-mediated glucose and tyrosine metabolism.

Authors - Angel Loza-Valdes

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer rated this antibody 5 stars, using it at a 1:1000 dilution for Western Blot on liver tissue (lot 00040762). They confirmed that the antibody successfully detects PAH in liver tissue samples, providing a positive result with clear detection.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Angel (Verified Customer) (11-27-2020)

This antibody detects PAH in liver tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver tissue
PAH Antibody Western Blot validation (1:1000 dilution) in Liver tissue (Cat no:16347-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...